PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G03600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 144aa    MW: 15668.5 Da    PI: 8.5189
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G03600.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.78.7e-202761135
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                     C+ Cg+t+Tp+WR gp g+++LCnaCG++yrkk++
  OPUNC05G03600.1 27 CVECGATTTPMWRGGPTGPRSLCNACGIRYRKKRR 61
                     ********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.7822157IPR000679Zinc finger, GATA-type
SMARTSM004011.3E-152171IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-142263No hitNo description
Gene3DG3DSA:3.30.50.102.6E-152562IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.62E-122762No hitNo description
PfamPF003201.5E-172761IPR000679Zinc finger, GATA-type
PROSITE patternPS0034402752IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MGSSDQKVIG IAAAAAAAAA EEGRRCCVEC GATTTPMWRG GPTGPRSLCN ACGIRYRKKR  60
RQELGLDKKQ QQSHQQQEHH HHQQQQQEEH QQQEDHSDAA SSVKDSSSSS LQVVKKRRVL  120
MGVEEAAILL MALSSSSSPT LLHG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2410161e-112AK241016.1 Oryza sativa Japonica Group cDNA, clone: J065054C19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655008.13e-59PREDICTED: GATA transcription factor 23-like
RefseqXP_015692844.13e-59PREDICTED: GATA transcription factor 23-like
TrEMBLA0A0E0KYN41e-101A0A0E0KYN4_ORYPU; Uncharacterized protein
STRINGOB05G13650.19e-59(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67212854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.16e-20GATA transcription factor 23